PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG009970t1
Common NameTCM_009970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 320aa    MW: 35973.6 Da    PI: 4.3133
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG009970t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.9e-1885139357
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       k++++t++q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV +WFqNrRa+ k+
  Thecc1EG009970t1  85 KKRRLTATQVQFLERSFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKN 139
                       56689***********************************************995 PP

2HD-ZIP_I/II126.61.1e-4085174291
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       kkrrl++ qv++LE+sFe e+kLeperKv+la+eLglqprqva+WFqnrRAR+k+kqlEkdy++Lk++yd+lk++ ++L ke+e+L++e+
  Thecc1EG009970t1  85 KKRRLTATQVQFLERSFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKNKQLEKDYDSLKASYDELKTDYDNLLKEKEDLENEV 174
                       9*************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-1975142IPR009057Homeodomain-like
PROSITE profilePS5007117.44380140IPR001356Homeobox domain
SMARTSM003898.6E-1883144IPR001356Homeobox domain
CDDcd000861.04E-1785141No hitNo description
PfamPF000467.4E-1685138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-1987140IPR009057Homeodomain-like
PRINTSPR000314.9E-6111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000314.9E-6120136IPR000047Helix-turn-helix motif
PfamPF021832.0E-15140181IPR003106Leucine zipper, homeobox-associated
Gene3DG3DSA:1.20.5.3709.7E-4141176IPR014751DNA repair protein XRCC4, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006302Biological Processdouble-strand break repair
GO:0006310Biological ProcessDNA recombination
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEGGKICGSS NMNALIHSEQ LSCSSEVMES LWIPSSTSAL RGQKPIINYE NVNGVETTDM  60
LFFQPLDKEE SGDDDFHGSY RPPAKKRRLT ATQVQFLERS FEVENKLEPE RKVQLAKELG  120
LQPRQVAIWF QNRRARFKNK QLEKDYDSLK ASYDELKTDY DNLLKEKEDL ENEVLALKEK  180
LLNGEEGMEN SGSLDAINSS NAESKKPNCD TSPENVSRVP SPACKQEEAC SAKSDVFDSD  240
SPHYTDGNHS SLIEPADSSN AFEPDQSDFS QDEEDNLSKS LLHPPFFPKF EVDCYYDAPA  300
SSCNFALPVE DQSFWSSLY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARFKNKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007044376.10.0Homeobox-leucine zipper protein HAT5, putative isoform 1
TrEMBLA0A061E6H90.0A0A061E6H9_THECC; Homeobox-leucine zipper protein HAT5, putative isoform 1
STRINGVIT_01s0026g01550.t011e-123(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-38homeobox 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]